Protein Info for GFF2665 in Variovorax sp. SCN45

Annotation: FIG001454: Transglutaminase-like enzymes, putative cysteine proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 37 to 49 (13 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 85 to 101 (17 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 563 to 584 (22 residues), see Phobius details PF11992: TgpA_N" amino acids 21 to 338 (318 residues), 234.3 bits, see alignment E=1.9e-73 PF01841: Transglut_core" amino acids 380 to 486 (107 residues), 77.6 bits, see alignment E=8.9e-26

Best Hits

KEGG orthology group: None (inferred from 86% identity to vpe:Varpa_2241)

Predicted SEED Role

"FIG001454: Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (673 amino acids)

>GFF2665 FIG001454: Transglutaminase-like enzymes, putative cysteine proteases (Variovorax sp. SCN45)
MNKLMTRLAALPRDARDTLFLLTVIALIVLPQVENIPWWCTAITAMVLLWRGTLAVQALP
LPSKWWRAALLALTLAATYATHRTLLGRDAGVTLIVILLALKTLELRARRDAFVIFFLGF
FAMLTNFFYSQSLLTAFTMLLALLGLLTALVNAHMPVGRPPLWQAARTAGWMALAGAPIM
LALFLLFPRFAPLWGTPSDAMVGRSGLSNVMRVGTIAELALDDSIAARVRFESGKAPPQN
QLYFRGPVLAQFDGREWTSLPSWARGTQWTSNLRVSGEPVRYEVTLEPSNRPLLLTLDAA
PRAPEAPGFEVTGTPDLQWFANRPLNDLVRYRAESYTQFHSGPLKRTDGQLQAYLALPPG
TNPRTAQLAAEMRANPALAGADTAAFVQAALARLRTGGYSYTLEPGVYGDNTADEFWFDR
KQGFCEHIASAFVVLMRNLGVPSRIVTGYQGGDLNTVDNYWIIRQSDAHAWAEVWQEGTG
WVRVDPTASVAPGRIGQFQRLVQQPGLFAGAIGAMSPTLAQNIRAAWEAVNNGWNQWVLN
YTQSRQLNLLKNIGFEAPSLEDLAYVLLYLLVGASLAGAAWTLWERSRHDPWLRLLGQAR
ARLAKAGLQLPDTAPPRQMAQAADERFGPAAQAVRDWLLKLEAQRYAPATPDSLSTLRAE
FRRLAWPAANPRG