Protein Info for PS417_13585 in Pseudomonas simiae WCS417

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF12146: Hydrolase_4" amino acids 30 to 246 (217 residues), 39.7 bits, see alignment E=9.2e-14 PF12697: Abhydrolase_6" amino acids 35 to 255 (221 residues), 89 bits, see alignment E=1.8e-28 PF12695: Abhydrolase_5" amino acids 35 to 127 (93 residues), 39.9 bits, see alignment E=9.4e-14

Best Hits

KEGG orthology group: None (inferred from 61% identity to rlt:Rleg2_2482)

Predicted SEED Role

"Probable signal peptide protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFE9 at UniProt or InterPro

Protein Sequence (266 amino acids)

>PS417_13585 alpha/beta hydrolase (Pseudomonas simiae WCS417)
MKTFKFSRVAAALITGALAFGAATASFAAPQKATVVLVHGAFADASSWNGVIAGLKAEGY
PVVAVANPLRSVKTDSDYVADIVAHTPGPVILVGHSYGGSVITNAVHGSDKVKALVYVAA
FAPEKGETAFELSGRYPGGTLGPTLDKPVVSKDGVTDLYIQQDKFNSQFAADVAPKEAQL
MAAGQRPITEAALKEPSGDPAWKSVPSYFIYGSADKNIPEAALKFMADRAGSKETVDVKG
ASHVVMVSNPARVVAIINDAAKANAQ