Protein Info for GFF2661 in Variovorax sp. SCN45

Annotation: Potassium efflux system KefA protein / Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 226 to 255 (30 residues), see Phobius details PF21088: MS_channel_1st" amino acids 204 to 243 (40 residues), 25.1 bits, see alignment 2.1e-09 PF00924: MS_channel_2nd" amino acids 245 to 310 (66 residues), 69.1 bits, see alignment E=4.4e-23 PF21082: MS_channel_3rd" amino acids 318 to 402 (85 residues), 50.9 bits, see alignment E=2.7e-17

Best Hits

KEGG orthology group: None (inferred from 91% identity to vpe:Varpa_2245)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>GFF2661 Potassium efflux system KefA protein / Small-conductance mechanosensitive channel (Variovorax sp. SCN45)
MNFNDFTQRLSQVEARGIAIELAVLAACVALAWGVCKWFGRDQPKDSIWFGERTFDGVLF
PLLALMLTDLARRAVIDFQTVLVLRIAVSMFLSLAVIRLFARVLRAVFPASNLVRLLERT
VSWLAWIAAVLWIVGLLPPVLAELDDITLAFGKTRVSLQTIIQGVLSAGLVMVIALWISS
TVEKRILREAVTDLSMRKVASNAVRAFLLLIGLLFALSAVGVDLTALSVLGGALGVGLGF
GLQKLASNYVSGFVILLERSIRIGDNVKVDTFEGRITDIKTRYTLIRAGNGREAIVPNES
LITSRVENLSLADRKFNITTTIVVGYESDVAQVQSILCEAAKAQPRVMTDPAPVAFLMNF
APDGLEFTLNFWVTDPDKGKDNLRSAINIAILDGLRGAGIDIPYPQRVVRVESLPPGVAS
APDAVL