Protein Info for PS417_13560 in Pseudomonas simiae WCS417

Annotation: nickel permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 154 to 179 (26 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 119 (109 residues), 70 bits, see alignment E=1e-23 PF00528: BPD_transp_1" amino acids 30 to 223 (194 residues), 75.1 bits, see alignment E=3e-25

Best Hits

Swiss-Prot: 41% identical to OCCM_RHIRD: Octopine transport system permease protein OccM (occM) from Rhizobium radiobacter

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 62% identity to pfl:PFL_5023)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9P9 at UniProt or InterPro

Protein Sequence (232 amino acids)

>PS417_13560 nickel permease (Pseudomonas simiae WCS417)
MPDWISYYAGLIAKGLQTTLSLLVISALLGFALAVLVALARLSRRKWLARGAQAYTSVLR
GTPLLIQIYIFYYGLGSLFAQFPMIRGSFLWPYLRDGYWYIVFALVLSVGAYVGEVIRGG
LLAVPKGEMEAASAFGMTPRQALLRVRLPRAMRLLLPTLAGETVMLLKSTALASTIAVVD
LLGAANVVRAQTLQIYQPLLLVAAVYLCLTFLIEGVYAIAERRGTPLRRSAG