Protein Info for PS417_13555 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 121 (107 residues), 60.4 bits, see alignment E=1e-20 PF00528: BPD_transp_1" amino acids 34 to 228 (195 residues), 86.1 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 38% identical to HISQ_ECOLI: Histidine transport system permease protein HisQ (hisQ) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 56% identity to pfl:PFL_5022)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UHW9 at UniProt or InterPro

Protein Sequence (234 amino acids)

>PS417_13555 ABC transporter permease (Pseudomonas simiae WCS417)
MFDLLSFDEQGWGNALLKGLWMTLQISAGSFAVGVLIGLVVACLKLSAPRPIALLMRGYT
TVFRAVPELLLILLLYYAGSMGLNALMLWMGFAQMNISGPLVAILVLGLVQGAYASEIFR
AAILAIPHGQIEAARAFGLSGFGLFRRVTLPIMAPFALAGMSNLWINLIKDSALISVVGT
NELLYTAKQAAGSTRQYLLFYLTAAALYYLVTLASNYLSGRLERRIRRWMPVVE