Protein Info for GFF2658 in Sphingobium sp. HT1-2

Annotation: Peptide deformylase (EC 3.5.1.88)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 77% identical to DEF_SPHWW: Peptide deformylase (def) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 92% identity to sjp:SJA_C1-24530)

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>GFF2658 Peptide deformylase (EC 3.5.1.88) (Sphingobium sp. HT1-2)
MAILPILEAPDPRLRTISTPVEAIDDDLQRLIDDMFETMYDAPGIGLAAIQVGVPKRILV
MDLQEPESDEEGAPPVKKPMVFINPEILKESDEQSVYNEGCLSVPDQFAEVERPAVIRAS
WMDRDGRIHEEQLEGLLATCLQHEMDHLEGVLFIDHLSRLKRDMLLKKLNKARRAA