Protein Info for GFF2655 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details PF00510: COX3" amino acids 71 to 197 (127 residues), 36.5 bits, see alignment E=2.5e-13

Best Hits

KEGG orthology group: None (inferred from 54% identity to smd:Smed_6356)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>GFF2655 hypothetical protein (Xanthobacter sp. DMC5)
MRPPDAPAPLSVAHLPTHGSGSRMPMWWGTLGFVVIEGLGFVFAVATYLYLLTQNRAWPM
APPPGLLWSGLFTVLMLMSEVPNRWTKKAAQAHDLRKVRLGVVTMSLVGALALVIRVFEF
TALNVRWDDNAYGSIVWLLIGVHTAHLVTDVAETWVVAGMLYIGPLDMRRFSDVDDNQAY
WDFVVLAWLPVYMVLYWLPRLVGGPP