Protein Info for GFF2655 in Variovorax sp. SCN45

Annotation: Efflux ABC transporter for glutathione/L-cysteine, essential for assembly of bd-type respiratory oxidases => CydD subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 237 to 262 (26 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 22 to 553 (532 residues), 504 bits, see alignment E=3.1e-155 PF00664: ABC_membrane" amino acids 141 to 272 (132 residues), 59.4 bits, see alignment E=7e-20 PF00005: ABC_tran" amino acids 365 to 511 (147 residues), 88.7 bits, see alignment E=8.4e-29 PF13304: AAA_21" amino acids 498 to 543 (46 residues), 29.2 bits, see alignment 1.4e-10

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 78% identity to vap:Vapar_3369)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (562 amino acids)

>GFF2655 Efflux ABC transporter for glutathione/L-cysteine, essential for assembly of bd-type respiratory oxidases => CydD subunit (Variovorax sp. SCN45)
MNKHSHHRSPLKAFASPDVGGVVQGAAALLWLPQAALLAMAVQGLASGQGLQAVWLPAGA
TLLLGLLRAACEAWGARRTFGRARAQLTALRAQTAEALAGGSPLDRGRAPSGQAASVLAE
QAEALVPYLVRYQPARWRATVVPIFILCAVAYFSWVAALVLLFAAPLIPIFMAIVGWRAK
AASEAQMVEMGGMNAFLLDRLRGLATLRALDAVDATAHRLGDAAQSLRVRTMAVLRIAFL
SSAVLELFSALGVAMVAVYVGFHLLGSLGFGTWGQPLSLGEGLFVLLLAPAFFEPLRELS
AVWHDRAAGEAALEALDGLQRHALPLPGANASLKRAAAGSAVAAPAIAVHGLHFSWPGET
REVFDGLELRVSAGEHIALTGPSGSGKTALLSLLAGLVPATSGEIAIGGVALTDHTIASL
RQRMAWMGQAPHVFAGSVEANVALGRTDVDTPRVTEAMRFAALDAVAQAHPGTALGEGGR
GLSGGEAVRLALARIAVHPHADLLLVDEPTAHLDSETAARVGDALVELARGKTLIVATHD
PVLAARMDRVVSLGAEAMEKAA