Protein Info for GFF2654 in Variovorax sp. SCN45

Annotation: Efflux ABC transporter for glutathione/L-cysteine, essential for assembly of bd-type respiratory oxidases => CydC subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 28 to 54 (27 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details TIGR02868: thiol reductant ABC exporter, CydC subunit" amino acids 25 to 531 (507 residues), 336.9 bits, see alignment E=1.1e-104 PF00005: ABC_tran" amino acids 368 to 502 (135 residues), 87.2 bits, see alignment E=7.9e-29

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 80% identity to vap:Vapar_3368)

Predicted SEED Role

"Transport ATP-binding protein CydC" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (571 amino acids)

>GFF2654 Efflux ABC transporter for glutathione/L-cysteine, essential for assembly of bd-type respiratory oxidases => CydC subunit (Variovorax sp. SCN45)
MNAGRTNTTQWRELRLVLRPFFVEQPRALLLGGLLAALTVLAGMALLGLSGWFITATALA
GLHAATAFTFDVFMPSAGIRLLALGRTASRYGERLVTHDATFGVLAALRVRLFRGWARPE
AARALLMRPARLLFRLTSDIDALESLYLRLLVPAAAALGAALLAGMVLGFMHVAMGAALA
LWLVFAGWGIAIVVARRARRPAIRRAHAIEALRARAVDLVAGQTDLVMAGRIDAQREALM
RADAQLAQADLALNRLEAASGFAYGSAGTLTLVGVLLVVGALVSEGVIGAPAAALALLVA
LTATEPFAALRRGALDAGRTWLAVRRLAPRMELAEDDATSAKPEDDAPFALQLKNITVTH
PGSRAEVLSDVSLTLQAGERVALVGTSGAGKSTLLAAIAAEITPRSGTVSAQPACLLTQR
TELFQDSLRDNLRLADPTASDERLWSVLQAAGLEADVRALSTGLDTRLGEGGLGLSGGQS
RRLALARLLLRPVPLWLLDEPTEALDAAVAHDVMQRLAQHAGPRTLLIATHLRREAALAD
RLVCMRHGRIVADLRRGSDAFDAALRSLRPD