Protein Info for GFF2653 in Xanthobacter sp. DMC5

Annotation: Cytochrome c oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 65 (28 residues), see Phobius details amino acids 87 to 111 (25 residues), see Phobius details TIGR02866: cytochrome c oxidase, subunit II" amino acids 33 to 236 (204 residues), 147.9 bits, see alignment E=1.4e-47 PF00116: COX2" amino acids 150 to 223 (74 residues), 59.5 bits, see alignment E=3.2e-20 PF00034: Cytochrom_C" amino acids 252 to 341 (90 residues), 32.7 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 50% identity to mci:Mesci_6199)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>GFF2653 Cytochrome c oxidase subunit 2 (Xanthobacter sp. DMC5)
VIRRMRLGLAFALAAVASGCARNPSILLDSAGPHAAAIAWLFWIFLAVSAVVWLLVIAAL
LFALCRSAPAGPDVPRLAPPARRERRLLRIVAACVGATVVVLTGFVGLSFAVDRQLIALD
REVDLVIRVTAHQWWWEVRYENEVPGLVFATANEIHVPVGRSVRLDLGSSDVIHSVWFPN
LAGKRDVIPGRDQSLTLRADKEGVWRGRCAEFCGNQHAFMGLTLVAEPEQDFVRWQEAQR
APAASPSTAVEARGMRVFLDGPCAMCHVIRGTPATGAGGIAPDLTHLKSRDTIGAGVAPN
RKGYLGGWILDPHGLKPGVHMPPVPQDSADFQALLAYLESLT