Protein Info for GFF2653 in Sphingobium sp. HT1-2

Annotation: Phosphate ABC transporter, permease protein PstC (TC 3.A.1.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 49 to 69 (21 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 233 to 260 (28 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 389 to 411 (23 residues), see Phobius details amino acids 432 to 454 (23 residues), see Phobius details PF12501: DUF3708" amino acids 7 to 181 (175 residues), 106.4 bits, see alignment E=1.3e-34 TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 167 to 459 (293 residues), 279.4 bits, see alignment E=1.4e-87 PF00528: BPD_transp_1" amino acids 249 to 460 (212 residues), 48.4 bits, see alignment E=9.6e-17

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 92% identity to sjp:SJA_C1-28870)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>GFF2653 Phosphate ABC transporter, permease protein PstC (TC 3.A.1.7.1) (Sphingobium sp. HT1-2)
MTGPAILLLLAGLGAIAWVSARARALRLAGVARASGRRDAVHSLPGYHGWYVALWTLIPA
GIFLAVWANVSPGLVTQSVLADPAAQSLPMDGFSRSAILGEARAIATGAQAGAFNPAANA
LVEPYRTALSHYGIAGAVLALVLAFAGGAYAFTRVRPDFRARTRVERLVMATLLIASLIA
IITTLGIVASLLWESFRFFSMVNPIDFLFGTKWSPQSAAMGYGNEDAFGAVPLFWGTIFI
GAIIAMIVAIPLGLMSAIYLTQYASPTVRKWMKPTLEMLAGVPTVVYGYFAALTIAPALR
DFAVMIGIHGASSESALAAGLVMGVMIIPFVSSMADDSIAAVPQSMRDGSLAMGATTSET
ISRVLIPAALPGVVGGVLLAVSRAIGETMIVVMAAGLAANLTLNPFASVTTVTTQIVQLL
TGDQEFDSAKTLAAFALGLVLFIVTLLLNIVALRVVKKYREAYE