Protein Info for GFF2643 in Sphingobium sp. HT1-2

Annotation: Chromate transport protein ChrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 324 to 348 (25 residues), see Phobius details amino acids 357 to 374 (18 residues), see Phobius details PF02417: Chromate_transp" amino acids 16 to 177 (162 residues), 122.4 bits, see alignment E=9.9e-40 amino acids 225 to 392 (168 residues), 106.6 bits, see alignment E=6.9e-35 TIGR00937: chromate efflux transporter" amino acids 20 to 388 (369 residues), 303.5 bits, see alignment E=1.6e-94

Best Hits

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>GFF2643 Chromate transport protein ChrA (Sphingobium sp. HT1-2)
MTTLDDGPPPIRLFPLFLKFLRFGCLAFGGPVAQIAMLRQTLVEEERWLSGPRFNRLLAV
MQILPGPEAHELCVHMGMMARGRIGGLLAGLGFMLPGLLLMLVAAWLYRDWIAGAGWALP
VLFGIQLVVLAIIARAVQRIGGHVLEDRLLWALAIGAFAATLLGTPFWIPLLAAGLVYGF
RARPMVIGVVLVGAVMLALLLHKGSVAVAPVPTVAGAARPDMLLLFIAGLKGGLLTFGGA
YTAIPYVRGDTVGRGWLSDGLFLDGVALAGILPAPLVIFATFAGYMAGGLGGALAITAGM
FLPAFAFSLIFYERLEALVENPALHHLLAGVAAAVVGVIAATLVQLGWAAAMRADRLWAA
GLILLVGAICAWRIKGRWSMPAIIALGGGAGWLLQP