Protein Info for GFF2642 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Pyruvate-flavodoxin oxidoreductase (EC 1.2.7.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02176: pyruvate:ferredoxin (flavodoxin) oxidoreductase
  • amino acids 1 to 1165 (1165 residues), 1615.4 bits, E=0
• PF01855: POR_N
  • amino acids 13 to 244 (232 residues), 279.2 bits, E=2.1e-86
• PF17147: PFOR_II
  • amino acids 265 to 347 (83 residues), 58.7 bits, 4.5e-19
• PF01558: POR
  • amino acids 420 to 608 (189 residues), 133.6 bits, E=5.6e-42
• PF10371: EKR
  • amino acids 626 to 678 (53 residues), 85.8 bits, see alignment (E = 9.7e-28)
• PF12837: Fer4_6
  • amino acids 681 to 704 (24 residues), 25.6 bits, see alignment (E = 6.2e-09)
• PF00037: Fer4
  • amino acids 682 to 705 (24 residues), 24.5 bits, see alignment (E = 1.2e-08)
  • amino acids 740 to 757 (18 residues), 22.1 bits, see alignment (E = 7.4e-08)
• PF13237: Fer4_10
  • amino acids 685 to 756 (72 residues), 29.5 bits, 4e-10
• PF13183: Fer4_8
  • amino acids 688 to 757 (70 residues), 28.6 bits, 1.2e-09
• PF12838: Fer4_7
  • amino acids 689 to 757 (69 residues), 39.4 bits, 4.7e-13
• PF13187: Fer4_9
  • amino acids 689 to 758 (70 residues), 30 bits, 3.1e-10
• PF13484: Fer4_16
  • amino acids 689 to 757 (69 residues), 37.6 bits, 2.1e-12

Best Hits

Swiss-Prot: 93% identical to NIFJ_ECOLI: Probable pyruvate-flavodoxin oxidoreductase (ydbK) from Escherichia coli (strain K12)

KEGG orthology group: K03737, putative pyruvate-flavodoxin oxidoreductase [EC: 1.2.7.-] (inferred from 75% identity to aha:AHA_3174)

MetaCyc: 93% identical to putative pyruvate-flavodoxin oxidoreductase (Escherichia coli K-12 substr. MG1655)
Pyruvate synthase. [EC: 1.2.7.1]

Predicted SEED Role

"Pyruvate-flavodoxin oxidoreductase (EC 1.2.7.-)" in subsystem Methionine Degradation or Pyruvate:ferredoxin oxidoreductase (EC 1.2.7.-)

MetaCyc Pathways

• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• pyruvate fermentation to ethanol III (3/3 steps found)
• L-alanine degradation V (oxidative Stickland reaction) (2/2 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (7/9 steps found)
• pyruvate decarboxylation to acetyl CoA III (1/1 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• reductive TCA cycle I (8/11 steps found)
• incomplete reductive TCA cycle (5/7 steps found)
• pyruvate fermentation to acetate VI (2/3 steps found)
• pyruvate fermentation to acetate and alanine (2/3 steps found)
• pyruvate fermentation to acetate III (1/2 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• reductive TCA cycle II (8/12 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (5/9 steps found)
• isopropanol biosynthesis (engineered) (2/5 steps found)
• pyruvate fermentation to acetone (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)
• Trinitrotoluene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.7.- or 1.2.7.1

Protein Sequence (1174 amino acids)

>GFF2642 Pyruvate-flavodoxin oxidoreductase (EC 1.2.7.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQTIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
GGAIAAVHGALQTGSLSTSFTSSQGLLLMIPTLYKLAGQLTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAASVQEAQDFALIAHRATLKSRVPFIHFFDGFRTSHEINKII
PLTNETILNLMPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
EAMKAFGDATGRQYQPFEYYGHPQAERVIIMMGSALGTCEEVVDELLIRGEKVGVLKVRL
FRPFSAKHLLQALPETVRAIAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRTI
GGRYGLSSKEFGPACVLAVFNELSRAKPKPRFTVGIYDDVTNLSLPLPENTLPGSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEKPIRSAYL
IAQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVVNAAKIARECGLGARINTVMQMAFFHLTHILPGDSALVELQGAIAKSYSSKGQDLVER
NWQALALAQESLAEVPLQAVNPHSAHRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPVWKEELCTQCNHCVAACPHSAIRAKVVSPQAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQDPQIKAINMMSRLEHVEEE
KVNYDFFLDLPEIERSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLSVDQHRARVMRL
LAQFADRIPAELNDALHAEATPDVRREQVAALRQHLKSVAGAEELLKDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAWPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKPPLALDSRPPSDALAETLLNEQRFRRLNAQQP
EVAEQLWRDAALDLQKRYDFLALLAGKAEKPGAD