Protein Info for GFF2641 in Sphingobium sp. HT1-2

Annotation: Peptidase M20D, amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01891: amidohydrolase" amino acids 55 to 398 (344 residues), 263.5 bits, see alignment E=1.6e-82 PF01546: Peptidase_M20" amino acids 112 to 416 (305 residues), 90.4 bits, see alignment E=1.6e-29 PF07687: M20_dimer" amino acids 231 to 330 (100 residues), 47.9 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 80% identity to sjp:SJA_C1-24650)

Predicted SEED Role

"N-acetyl-L,L-diaminopimelate deacetylase (EC 3.5.1.47)" in subsystem Lysine Biosynthesis DAP Pathway (EC 3.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.32 or 3.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>GFF2641 Peptidase M20D, amidohydrolase (Sphingobium sp. HT1-2)
MRHALTAFLAAVSFSSIAVAQTPAAPPPAQPAMVQPTPTPQSELPGLIARDMEGLMTLYR
DLHANPELSLQEVNTAAKLAKRLKAMKFDVTEKVGGTGVVAVMKNGSGPVLLIRADMDGL
PVVEQTGLDFASKVRTKTPEGVETSVMHACGHDTHMTAFIETAKLLSSQKDKWKGTLVMI
LQPAEEVGKGARDMLEDGLYTRFPRPTHAIAFHDAANLQAGVVGYTPGYALANVDSVDIV
VKGLGGHGAYPQTTRDPIVLGSRIVTSLQTLVSREQDPQDPAVVTVGSFQAGAKHNIIPD
QALLLLTVRSYSDETRAKLIKGIERIARGEAIAAGVPDDKMPVVSVKDEFTPSTYNPPEF
AEQMGALLKGHFAEGRVVKTPAVMGGEDFGRFYRADKSINSFIFWVGGVPADKMAAAEAG
QITLPSLHSPFWAPEADKVIATASEAMTVLAMDILKKD