Protein Info for GFF2635 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR02782: P-type conjugative transfer ATPase TrbB" amino acids 13 to 314 (302 residues), 431.1 bits, see alignment E=1.2e-133 PF00437: T2SSE" amino acids 106 to 287 (182 residues), 121.2 bits, see alignment E=4.3e-39 PF06414: Zeta_toxin" amino acids 150 to 214 (65 residues), 22.5 bits, see alignment E=6.9e-09

Best Hits

Swiss-Prot: 48% identical to TRBB_RHIRD: Conjugal transfer protein TrbB (trbB) from Rhizobium radiobacter

KEGG orthology group: K03196, type IV secretion system protein VirB11 (inferred from 93% identity to xau:Xaut_0595)

Predicted SEED Role

"Conjugative transfer protein TrbB" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>GFF2635 hypothetical protein (Xanthobacter sp. DMC5)
MAGSAHNPEGLTRGVRMLRTALGPVISHLLDNPAVVEVMLNPDGHLWVDRLSEGLASTGE
RLAAGDGERIIRLVAHHIGAEVHAGAPRISAELPGTGERFEGLLPPVVAAPTFAIRKPAV
AVFTLDDYVAAGIMSAPQAEALRHGVASRANILVAGGTSSGKTTLTNALLAEVAKTSERV
ILIEDTRELQCAAPNLVALRTKDGVASLSDLVRSSLRLRPDRIPIGEVRGAEALDLLKAW
GTGHPGGIGTIHAGSAIGTLRRLEQLIQEAVVTVPRALIAETIDLIAVLSGRGTARRLTE
LARVDGLGPDGDYRVSPAIPPAEEGTTP