Protein Info for GFF2630 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 44 (17 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 195 to 222 (28 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details

Best Hits

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>GFF2630 hypothetical protein (Xanthobacter sp. DMC5)
MALSMLTLGALLVPLIEGREAGWPLWSWLSLAGVPLLAWFFWRYEHRLARAGGAPLLDPH
ALRAPGLGRALLIALLFYSIGSFFLLFSIYLQDALHMTALQAGLVFLPFGPAFLLGPLST
PFLRRFCGAYVNPIGMGLEVIGFLGLAGLIAATLTGMHPAPAPLAALIFVVGFGQGLALP
TLMRMVTGRVAPALSGMIAGIASSTLQVSTALSVAVIGGIFYEVLGARTDPAAITQALIV
AVLCIAVCLAGGMGLSISLVRRTPPPHQTAEGKV