Protein Info for GFF2622 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details PF02743: dCache_1" amino acids 44 to 257 (214 residues), 47.1 bits, see alignment E=3.5e-16 PF22588: dCache_1_like" amino acids 184 to 268 (85 residues), 39.5 bits, see alignment E=8e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 320 to 486 (167 residues), 170.8 bits, see alignment E=1e-54 PF00990: GGDEF" amino acids 324 to 484 (161 residues), 160.6 bits, see alignment E=4.2e-51

Best Hits

KEGG orthology group: None (inferred from 43% identity to azc:AZC_3970)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (506 amino acids)

>GFF2622 hypothetical protein (Xanthobacter sp. DMC5)
MRRLVAGAYVPLIVAALIAIILLAQVLTLWRSYQATWLLAVHSAQNVMNTVAANIDRNLA
IIDLTLRGAEEAFSADGVRDLTPELRRMVLFDRAASARFLGALVIIDRGGNLIEESGSPQ
PRQMNFSDRDYFKAQLKEDAGTYVSAPFRSRLRDNDPSIALSRRIAGPDGSFEGVVAAAL
RIAFFQSLLDTVNLGPESVIAITRTDGTVILRSPSTDGKGNTGLNVAGSPVFQRMIAKPG
EQFSERSQLDGIDRYYLDTIIGDFPLLLSVGISPAAAMAEWTEGALISSALTAGMCVLLI
VLIRTLRLALIRSQEVEEQLEILAVTDELTGLPNRRAFDLALASEVRRAARHHTSLAVLM
VDVDHFKRVNDRFGHAVGDVVLARIAKEISRSIRRPGDFAARYGGEEFVALLPATEAGGA
SFIAERIRTAIASMDPCPIEPALGKVTVSIGVAAAMVPPSSSGVALVTWADRALYEAKGA
GRNRVACYREDELATPTSGGRMPSGG