Protein Info for GFF2621 in Variovorax sp. SCN45

Annotation: YidE/YbjL duplication

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 444 to 464 (21 residues), see Phobius details amino acids 470 to 490 (21 residues), see Phobius details amino acids 502 to 519 (18 residues), see Phobius details amino acids 534 to 559 (26 residues), see Phobius details TIGR03802: aspartate-alanine antiporter" amino acids 4 to 553 (550 residues), 617.3 bits, see alignment E=2.8e-189 PF06826: Asp-Al_Ex" amino acids 15 to 177 (163 residues), 106.7 bits, see alignment E=1.2e-34 amino acids 384 to 551 (168 residues), 110.8 bits, see alignment E=6.4e-36 TIGR01625: AspT/YidE/YbjL antiporter duplication domain" amino acids 388 to 538 (151 residues), 92.3 bits, see alignment E=2.7e-30

Best Hits

KEGG orthology group: None (inferred from 67% identity to mms:mma_1082)

Predicted SEED Role

"putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (562 amino acids)

>GFF2621 YidE/YbjL duplication (Variovorax sp. SCN45)
MVTLTAILQGQPEIALFLVLAIGYAVGQIRFGPIQLGGICGTLIAALVVGQLGIKLDDSV
KNVFFMLFIFALGYAGGPQFFANLDAKGLRLGLLCLVEVVAVLALVLTATLFLSLDQGTA
AGLMAGAATESAVVGTATDAISKLALPLPDIQQLQANVVTAYSITYVFGLIAIVVATSQI
FPLVLRVDLRAEADKLWKTMGGGGDDAESASAVPEMVGRVFLVTVGRGRTVGELTRMFGG
HASIERVMRRGQSLAVEPTLRLQAFDQVLAIGRRSVLVNVAELLGREFANTTAFDAVVET
TEVVVNRREWFGRELHELGAPLPRGVQIVGLSRDGNAMPLLHDVELQRGDVLKLYGPVLD
VSRALPLLGDRVVESTHSNISYAAMGILLGVFIGGFSVKLGGIPFSLGTGGGALLTGLAF
GWYQSKNPHRLSVPPEALALMKDLGLATFIACVGLASGPQALALIKKFGIALPLVGVAIA
VVPASISLFVGHRLLKLEAPVLLGAIAGQQCSTPALSAVQNAAGNATPLLGYTITYAISN
VVLPLMGPLIVALAGLVAHAAK