Protein Info for GFF2618 in Sphingobium sp. HT1-2

Annotation: Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.66)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family" amino acids 18 to 207 (190 residues), 153.3 bits, see alignment E=2.4e-49 PF01725: Ham1p_like" amino acids 19 to 206 (188 residues), 197.1 bits, see alignment E=1.3e-62

Best Hits

Swiss-Prot: 60% identical to IXTPA_ZYMMO: dITP/XTP pyrophosphatase (ZMO0013) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 85% identity to sjp:SJA_C1-10650)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>GFF2618 Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.66) (Sphingobium sp. HT1-2)
MSDEYGQEQAIRKLKPGKLVIASHNAGKVREIAALLGPYGIEPISAASLDLPEPEETGTT
FIANAELKAMQAADLSGLPALADDSGLCVEALNGDPGLFSARWAGPDKDFGMAMQKVWDG
VQAKGPDAGHGAHFICALALAWPDGHVEAFEGRVDGLLVWPPRGANGFGYDAMFQPLGHD
ISFGEMDPDAKHAMSHRADAFAQLVKAVI