Protein Info for GFF2611 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: two-component hybrid sensor and regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details PF00512: HisKA" amino acids 223 to 292 (70 residues), 36.6 bits, see alignment E=3.9e-13 PF02518: HATPase_c" amino acids 337 to 446 (110 residues), 87.6 bits, see alignment E=8.1e-29

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (593 amino acids)

>GFF2611 two-component hybrid sensor and regulator (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPNTVKSMDLEQRLLHEQVSILLNHLPGMAVGTVVLASGVAWLLILQDQPAVKVLGWLAS
MALYSIFRLVLLLGRRRYPPAGANLRQWALALTVASGGAGAMWGAIPWLFFTHDDLYAQA
VIAIALCGILASATQSIGAYWPAHLAFAIPCALPFSIHCLIEGGSASITLGVLSLLFLAF
SASFARSIPLSLRQSIALRMENEALVESLTRAKEHAEAADRRKTRFLAAASHDLRQPIHA
MGLFVPALQRLVRHARPSPHALTDIADRMHSVLESMGQLLHVLMEISRLDSGVVTVRRSP
CAVNPVLQQVGEVLREQAKAKGLRLRLVETPLWVRADPAVLHTVMLNLVTNAVRYCKHGG
VLVGARRRGGEVEIQVWDTGIGIPEQDLPRVFDEFYQARNAHRASAQTRGFGLGLSIVQR
SAELLDARLDVHSRLGRGSVFSVFLQRCEAQADAPGVRKTPAPTASGQVVLVLDNDEQVV
RALTHLLTGVGHTVLGAQAMREALVLAWNNSASISLIVADYHLSETFDGLQAIARLRGIL
ERDVPALIITGDASVHLTDEDGDQDIVLLNKPVDPRALLRWMNEATPTPATID