Protein Info for PS417_01330 in Pseudomonas simiae WCS417

Annotation: dTDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 174 (174 residues), 53.3 bits, see alignment E=8e-18 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 2 to 339 (338 residues), 508.6 bits, see alignment E=3.2e-157 PF01370: Epimerase" amino acids 3 to 251 (249 residues), 244.6 bits, see alignment E=3.4e-76 PF02719: Polysacc_synt_2" amino acids 3 to 113 (111 residues), 52.3 bits, see alignment E=1.7e-17 PF01073: 3Beta_HSD" amino acids 4 to 172 (169 residues), 48.3 bits, see alignment E=2.6e-16 PF16363: GDP_Man_Dehyd" amino acids 4 to 326 (323 residues), 309.9 bits, see alignment E=9.7e-96 PF07993: NAD_binding_4" amino acids 5 to 187 (183 residues), 38.3 bits, see alignment E=3.2e-13

Best Hits

Swiss-Prot: 74% identical to RMLB2_ECOLI: dTDP-glucose 4,6-dehydratase 2 (rffG) from Escherichia coli (strain K12)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 94% identity to pfs:PFLU0291)

MetaCyc: 74% identical to dTDP-glucose 4,6-dehydratase 2 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0V7 at UniProt or InterPro

Protein Sequence (360 amino acids)

>PS417_01330 dTDP-glucose 4,6-dehydratase (Pseudomonas simiae WCS417)
MRILITGGAGFIGSALIRHLIQHTEHEVLNLDKLTYAGNLESLASIASNSRYEFVQADII
DQATVSAILERFEPQAIMHLAAESHVDRSIDGPSDFIQTNIVGTYSLLEAARAYWQTLAE
PAKGNFRFHHISTDEVYGDLHGVDDLFTETTPYAPSSPYSASKAASDHLVRAWQRTYGLP
VLLTNCSNNYGPFHFPEKLIPLVILNALAGKPLPVYGNGLQVRDWLFVEDHARALLKVVT
EGTVGETYNIGGHNEQKNIDVVRGICQLLEELAPQRPSGVEKFADLITFVKDRPGHDQRY
AIDASKIERELGWVPEETFESGLRKTVQWYLDNLEWCRRVQDGSYQGERLGNTDFKDLIA