Protein Info for GFF2605 in Sphingobium sp. HT1-2

Annotation: TonB-dependent hemin, ferrichrome receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 44 to 697 (654 residues), 403.4 bits, see alignment E=9.8e-125 PF07715: Plug" amino acids 54 to 164 (111 residues), 93.4 bits, see alignment E=1.3e-30 PF00593: TonB_dep_Rec_b-barrel" amino acids 264 to 670 (407 residues), 197.3 bits, see alignment E=9e-62

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 89% identity to sch:Sphch_0509)

Predicted SEED Role

"TonB-dependent hemin , ferrichrome receptor" in subsystem Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (697 amino acids)

>GFF2605 TonB-dependent hemin, ferrichrome receptor (Sphingobium sp. HT1-2)
MTKSKTLLLLGTALIALPLPAMAQAQSDDIAVASDSQFALDRMIISAGVEKVALDTPQAV
TALDQEDIDQLQATTIGDLLEGMPGVNVQGGVGQLGQGFNIRGMGTAIGDSDNRILMTVD
GVTKFYEQYRMGAFFSEPELYKRVEVLRGPASSTLYGAGALAGVINFTTKDASDFLRDGD
KLAVRLKGATETNAQGHTLSGIVATEPVDGVELLGSYNYRRTDDYKSGNGDTVAASATES
DSWLVKGRVAIGGNKKHAIWASYQDWISDAPQVYDQISAATGSSLMRRRVHDKTAVLGYV
NDFNGSKFFNVEAQVAYSLSKVHQTETTFLGANLEYSDFSYESWQAKVQNTSEFAMGGDW
TTFLILGGQWSTQERRNPRVNFDGTVTPGAGTHPEGDMDRYGLFGQLEIVWSDKLTIMPD
VRVDWTRLTPGDTVVGGTVLTDKVKDSGVSPKLAALYNITPWFGLFGSVARTVRMPNIDE
IFTRSATRPNNPDLKPEKSDNYEAGFTLSFDDMLGKNDRFRAKTTLFQNDVKDLIVNVSA
AAGTPYFQNINRSRFKGIELEAEYGMGGFYARGNASFIDGKNRLTGDYLNTIPANDYRLT
LGYNDVASGLSGGWTGEFAERQDKVTPGSFASAGSGLATPGYSVHNLFFAFKPQGGVAKG
FEFRIAMDNIFDKQYRRHLSSLAAEGQSFRFTVANTF