Protein Info for GFF2603 in Sphingobium sp. HT1-2

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 723 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF07715: Plug" amino acids 62 to 164 (103 residues), 55.6 bits, see alignment E=6.8e-19 TIGR01783: TonB-dependent siderophore receptor" amino acids 64 to 720 (657 residues), 329.6 bits, see alignment E=2.3e-102 PF00593: TonB_dep_Rec_b-barrel" amino acids 241 to 693 (453 residues), 151.2 bits, see alignment E=8.8e-48

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 49% identity to cja:CJA_1868)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (723 amino acids)

>GFF2603 TonB-dependent siderophore receptor (Sphingobium sp. HT1-2)
MSFASKKNFVRYGAASIAACLLLANTGAQAQAPADEPDANAPAPDSIVVTGQNETNGLNL
TARETPQSVTSLDSLRMQEQGLTDISEVMAQIVGIQTNRSSALGTDGTNYTARGFAVQNY
LVDGVARPSNIYGFTEDTADMIAYDRIEVIRGSAGMMTGTGEPSAAINMIRKRPGADLSA
TVAATIGSWDKYRLEGDIGGALTASGHVRARVAGAWQDNDTFIDREHAKRQALYGVIEAD
LGPSTLLTAGIEYQNFRNEGASRGGVPLFFTDGTKTNFARSTNGGADWSDFRRKSVNIFA
SIAHDFDANWHLRVDAEHKSGSYDETIGYYFGTAIDKDTGDGGTFYATRWASDLTLDAVY
ANLRGAFQALGQEQHVALTLSHTRFDDDQTPYPGWWGGSDYMYPINAYSYFPTGDVAKPD
LTPSGGTAGNRIETSSIAGVARLKPIGPLSIIAGGRLTWWKQDSYAQDVTGPKVWSPVVD
EKAVFTPYAGLVLDFTKTLSAYVSYASVFKPQTSRTVDGDVIAPLEGNTYEAGLKADFLD
GRLSATAAVFKMQQDNYALADGPGIFAPDGSSAYHAVSGMKSSGFELEVKGEILPGWRIA
GGFANARAEDRDGVRQMPQIAKNSFKMFSAYTLPGQFSALTIGGNVEWQGKTTADGEGPN
GETYSQGSLAVVDLLANYRFTDHLSLAVHVENIFDKTYYSGLYLGSARYGEPRAVKFTLR
GTL