Protein Info for PS417_13250 in Pseudomonas simiae WCS417

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 122 to 152 (31 residues), see Phobius details amino acids 156 to 169 (14 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details PF00664: ABC_membrane" amino acids 38 to 287 (250 residues), 52.2 bits, see alignment E=1.1e-17 PF00005: ABC_tran" amino acids 347 to 496 (150 residues), 97.3 bits, see alignment E=1.8e-31 PF02463: SMC_N" amino acids 356 to 537 (182 residues), 40.5 bits, see alignment E=3.1e-14

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 62% identity to rru:Rru_A2339)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9I7 at UniProt or InterPro

Protein Sequence (581 amino acids)

>PS417_13250 ABC transporter (Pseudomonas simiae WCS417)
MIRSLVTLLGPPHASRLYRYLAWLVTSAVLQGLAVALLVPILHALFVGDLPSAMTWLAGL
AAMVVLTCIAHYQQAMQGFALALLVLTTLHDRLGQHLVSLPLGWFNSEKVGRLSRSATSG
TLMVTGLFAHYLGPVVSGVVVPATVALTLFVFDWRLGLTAVLCAPLIYFAHHWSAAAIGS
NDARVEAAATLAGNRVVEFARYQQVLRAFGRTQDGYAPLQAANQAQKQAGGSMLSQTFPK
LLAGGLTVQLAFALLVGVGITLAAHGEIDAIQLVALLALAARFVGPLAEAAARSGLLRMA
GNDLDQLVGILREPSLPEPVVSQPLSAPGSLAFEQVSFAYPSGPTVLQDLTFSAPAHSMT
AIVGASGSGKTTVTRLLMRFFDTTTGSVKVGGVDVREQSSEALMAQLSLVMQDVYLFDDS
LEANIRVGSPDASARDVAEAARLAGVDEIVARLPQGWNTPVGEGGASLSGGERQRVSLAR
ALLKRAPIVLLDEATAALDPHNEAFVQAAIQRLMQNSTVLVIAHRLPTIMAADQILVLDQ
GRLVESGTHAQLLSLNGRYAGFWHDRQRAGGWRLNAQAQPC