Protein Info for GFF2600 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: tRNA-specific 2-thiouridylase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02568: ThiI" amino acids 4 to 39 (36 residues), 22.6 bits, see alignment 1.8e-08 PF02540: NAD_synthase" amino acids 4 to 77 (74 residues), 27.5 bits, see alignment E=4.3e-10 PF03054: tRNA_Me_trans" amino acids 5 to 200 (196 residues), 269.3 bits, see alignment E=5.1e-84 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 5 to 364 (360 residues), 430.1 bits, see alignment E=2.7e-133 PF20259: tRNA_Me_trans_M" amino acids 205 to 280 (76 residues), 76.6 bits, see alignment E=2.1e-25 PF20258: tRNA_Me_trans_C" amino acids 292 to 364 (73 residues), 74.6 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 82% identical to MNMA_ACIET: tRNA-specific 2-thiouridylase MnmA (mnmA) from Acidovorax ebreus (strain TPSY)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 83% identity to adn:Alide_4298)

MetaCyc: 57% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>GFF2600 tRNA-specific 2-thiouridylase MnmA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MASKQRVVVGLSGGVDSAVSAYLLKQQGYEVIGIFMKNWEDDDDSEYCSTRQDFLDAASV
ADVLGIDIEHVNFAAEYKDRVFAEFLREYQAGRTPNPDILCNAEIKFKAFLDHAMRLGAE
KIATGHYARVRERAGAFELLKGRDPLKDQSYFLHRLNQAQLAKTLFPVGELPKTEVRRIA
AEINLPNAKKKDSTGICFIGERPFRDFLNRYIAKEPGPIKDAKGRVLGQHVGLSFYTLGQ
RQGLGIGGVREKGAQKGGNDHAPWFVARKDVEKNTLWVVQGHDHPWLLTPRLRAQDASWV
AGRPPEAAALAAKTRYRQADAPCRFEAEGESGFALDFTDPQWAVTPGQSAVLYDGEVCLG
GGVITTDAASFQAPPASARPVAA