Protein Info for GFF2598 in Sphingobium sp. HT1-2

Annotation: Quinohemoprotein amine dehydrogenase radical SAM maturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 TIGR03906: quinohemoprotein amine dehydrogenase maturation protein" amino acids 13 to 480 (468 residues), 657.1 bits, see alignment E=1.4e-201 PF04055: Radical_SAM" amino acids 108 to 276 (169 residues), 57.9 bits, see alignment E=1.5e-19 PF13353: Fer4_12" amino acids 112 to 245 (134 residues), 29.4 bits, see alignment E=9.3e-11 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 359 to 447 (89 residues), 54.8 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: K06871, (no description) (inferred from 73% identity to nar:Saro_3029)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>GFF2598 Quinohemoprotein amine dehydrogenase radical SAM maturase (Sphingobium sp. HT1-2)
MTVMQAPAYRRAEYHGFAAGGSDFVYLVSAGAIFEIDAQVQAVLDRLDGQELSHAALVRE
LAGEEGDLAEAEALLRELRAVQLIHLGAAPVSVPEAPPADFPLQALVLNITNQCNLACTY
CYEFGADKIATPAGKPKYMTLETARASVDLLIAEAAHRPSVHITFFGGETLMNFKLLRDV
VDYANGATAAAGKGITYSLTTNATLLTPEIVTFLSDNRVGVTVSMDGPPELQDKHRVYKN
GKGSYAVIEPRLRTLIAHHRTRAVTARVTLTEGVTDVVRIFRHLKDDLGFHEVGFAPVTT
GETRAYSIDADGMDYVLAQFNLLAREWLEYALRGEMHGFTNVSETISELISGVNKSHPCG
AGMGLMGVSPSGDLSPCHRFTDADTHVMGHVSSGIDRAKQGDFLSRGHVGAKYDCQSCWA
RPLCAGGCHHEAFVRYGDTGHANLHYCDWIRQWTDTCLHIYGELAVKNPGFLEHFAERKG
LS