Protein Info for GFF2594 in Sphingobium sp. HT1-2

Annotation: Efflux ABC transporter, permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 67 to 87 (21 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 27 to 296 (270 residues), 151.5 bits, see alignment E=4e-48 PF00005: ABC_tran" amino acids 359 to 508 (150 residues), 108.8 bits, see alignment E=3.4e-35

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 65% identity to nar:Saro_3033)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (566 amino acids)

>GFF2594 Efflux ABC transporter, permease/ATP-binding protein (Sphingobium sp. HT1-2)
MSAPAPVAEWRSYRRLLPYIRPYRRGLLLVLAISVLSTALGLAQPYLSKLMIDQALLRRD
MGALWRIAGIMITVTILGFGVNILASYRYVRLSAAMLYDMRAALLRHLQTLSPRFYASFR
LGDLVSRMNSDVSDVQRIASDTLLSVVSNLLFFIGCVAMMLWLDWRLFLVGILLVPASLA
AFTHYQRRLTTLTRDMRERGADLGSLLVDTVMGMRVVTALRAGEHEVGRFKAKNDAFVGA
MLRMQLASYMTGALPGTLMTGATSAVILYGGWRIIEGDMSIGTLVAFMTYHMRLLSPIQT
LMGLTSGLASARVSLGRIFELFDTRPDVEERADAVAIGRVRGDIRFEQVAMRYDRDPVLR
DMDLTISAGSICAILGPSGVGKSTMADLIVRHADPTGGRILLDGHDLRDLRLDDLRREVM
LVDQSPWLFNDSIAANIGFALPDVRIEDIEAAAHAAGLDAFLARLPEGLDTRTGERGLAL
SAGERQRIVIARALLRRPSVLILDEPTSALDGETEALVAQRLRGALPDATIILITHKPAL
ARIADRIVMITDGQAHVAQQPEPAHA