Protein Info for GFF2594 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: putative collagenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 PF01136: Peptidase_U32" amino acids 79 to 305 (227 residues), 247.1 bits, see alignment E=1.5e-77 PF12392: DUF3656" amino acids 391 to 505 (115 residues), 75.2 bits, see alignment E=6.5e-25

Best Hits

Swiss-Prot: 92% identical to RLHA_ECOLI: 23S rRNA 5-hydroxycytidine C2501 synthase (rlhA) from Escherichia coli (strain K12)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 92% identity to eco:b1435)

MetaCyc: 92% identical to 23S rRNA 5-hydroxycytidine C2501 synthase (Escherichia coli K-12 substr. MG1655)
RXN-21990

Predicted SEED Role

"putative collagenase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (654 amino acids)

>GFF2594 putative collagenase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRQQPHYLELLSPARDAAIAREAILHGADAVYIGGPGFGARHNASNSLRDIADLVPFAHR
YGARIFVTLNTILHDDELEPAQRLITDLYNTGVDALIVQDMGILELDIPPIELHASTQCD
IRSVEKAKFLADVGFSQIVLARELNLSQIAAIHQATDATIEFFIHGALCVAYSGQCYISH
AQTGRSANRGDCSQACRLPYTLKDDQGRVVSYEKHLLSMKDNDQTANLGALIDAGVRSFK
IEGRYKDMSYVKNITAHYRQMLDAIIEQRGDLARASVGRTEHFFVPSTEKTFHRGSTDYF
VNARKGDIGAFDSPKFIGLPVGEVLNVAKDYLDVEATEPLANGDGLNVLIKREVVGFRAN
TVEKTGHNRYRVWPNDMPADLHKVRPHHPLNRNLDHNWQQALTKTSSERRVAVDIMLGGW
QEQLILTLTSEDGVCITHTLDGVFEEANNSEKALNNLKAGLAKLGQTPYYARDMQVTLPA
ALFVPNSLLNQFRREAIDMLDAARLAHYQRGRRKPVAQPAPVYPQTHLSFLANVYNHKAR
EFYHRYGVQLIDAAYEAHQEKGEVPVMITKHCLRFAFNLCPKQAKGNIKSWKATPMQLVH
GDEVLTLKFDCRPCEMHVIGKIKNHILKMPQPGSVVASVSPEALMKTLPKRRGV