Protein Info for GFF2593 in Variovorax sp. SCN45

Annotation: Integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details PF06736: TMEM175" amino acids 6 to 98 (93 residues), 72.1 bits, see alignment E=2.2e-24

Best Hits

KEGG orthology group: None (inferred from 46% identity to rpe:RPE_2999)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>GFF2593 Integral membrane protein (Variovorax sp. SCN45)
MYPKNRLDALTDGIFAVAMTILVLDLRIPDETAVGASEASFYQALLALSPKFVPYLLSFY
VLGASWLSLIKARSRGESVGAGYAKWSLFYLLFVTLLPFSTVLMGRFTSHTVATAIYAVN
IGIMAATAFLLMSLLPDPVKDAHWVDRRISLLVLLASCVLTIVLSFFSPGKALFAFLLNG
LAGTLVRLYLRRVPTPG