Protein Info for GFF2592 in Xanthobacter sp. DMC5

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 277 (270 residues), 138.8 bits, see alignment E=9.7e-45 TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 9 to 287 (279 residues), 262.2 bits, see alignment E=3.8e-82

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 62% identity to aav:Aave_3820)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>GFF2592 High-affinity branched-chain amino acid transport system permease protein LivH (Xanthobacter sp. DMC5)
MQSFVLLALNALTYISILALVAVGLAIVFGMMDIINMAHGEFIAIGAYTVATTQSIAGAG
HSEATFWIGLAMAPLMGAIGGLVLETLVIRPLYHRTLDTLLATFAISLMAQKALELVFGP
QPQLVSAPLSGAVPVLGESYPSYRLFIIVVAMATLAACAIMFSRSRFGTDLRAVIQNPTM
AEALGINTRRLNRTAFTAGAALAGLAGALIAPLASVEAHLGLAYLGKAFFVIILGGVGSI
LGSIVGSVVVGGGETLLNYAVDPSLASALVLLIAIIVIRFRPKGLIPGYSAAHELLGRG