Protein Info for GFF2591 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 314 (266 residues), 112.5 bits, see alignment E=1e-36

Best Hits

KEGG orthology group: None (inferred from 58% identity to aav:Aave_3819)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtC" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>GFF2591 hypothetical protein (Xanthobacter sp. DMC5)
MAVPSILRLMFAQPPLDPGDRRFLGGLLCAAMLVAGLPAILSGYGLLALRDGLIMGLFAV
SYDLIWGKARTLTLGHGAFFGLGAYGFAIATVPFGLSVGAGLVLGVAAAGLLAVLVGYFL
IYANVRLHFFAVITVALLVILGQLAVSWSSVTGGDVGILGVPGLPVLFGAVDLSADLPSF
YLVAAVLLAVILLLWSGCRGNYGRVLAAIGMNEFRAKTFGYDTSFHILMAFVASAVLAGA
AGALFATTSGVVAPDLFSPLLSTQVILWVAVGGRGTLLGPACAAVVLTRLQQEVSSYSTS
FWPLIAGSLFLTLILFAPEGAPGLLRRAKAALWWRGTESEAARHG