Protein Info for GFF2585 in Sphingobium sp. HT1-2

Annotation: Two-component system sensor histidine kinase/response regulator hybrid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 TIGR00229: PAS domain S-box protein" amino acids 171 to 281 (111 residues), 49.5 bits, see alignment E=2.2e-17 PF00989: PAS" amino acids 172 to 264 (93 residues), 35.9 bits, see alignment E=2.4e-12 PF08448: PAS_4" amino acids 178 to 277 (100 residues), 40 bits, see alignment E=1.5e-13 PF13426: PAS_9" amino acids 179 to 274 (96 residues), 21.5 bits, see alignment E=8.3e-08 PF08447: PAS_3" amino acids 192 to 261 (70 residues), 42.7 bits, see alignment E=1.9e-14 PF00512: HisKA" amino acids 299 to 363 (65 residues), 27.6 bits, see alignment E=8.7e-10 PF02518: HATPase_c" amino acids 407 to 527 (121 residues), 69.7 bits, see alignment E=9.9e-23 PF00072: Response_reg" amino acids 554 to 666 (113 residues), 51.4 bits, see alignment E=4.1e-17

Best Hits

KEGG orthology group: None (inferred from 79% identity to sjp:SJA_C1-06010)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (678 amino acids)

>GFF2585 Two-component system sensor histidine kinase/response regulator hybrid (Sphingobium sp. HT1-2)
MSQQRDIADMIAEQGPMGALTATIDATSPLGPASAWSPSLVSTVRLMLSSRAEIVLFWGP
DYCALYNEAYAPTIGDKHPRVLGRPAREGWAELWDDLGPLLQSVRDTGETFHAKDRPFYI
ERDGGRGEEVFFDISYSPVFELDGSIGGVLCIVSETTVRVLAEREARADRNRLWALARDP
FLIADSEGIWLSASPAWTDILGWSQEELIGRTSEWMEHPDDVKRTRGEVQDLADGHPTIR
FENRFRTKRGDYRIFSWTAVPEGDLIYCVARDVTRHRADAQALAETEAALRQAQKMETLG
QLTGGVAHDFNNLLQIVTGNLDLLQRALPDDQPRLRRAADNAMAGAERAAILTQRLLAFS
RRQPLAPDRVDPNRLIAGMSDLLHRTLGEMIEVETVQSPRVWPVEIDVNQMENALLNLAV
NARDAMPQGGKLTIEVANTHLDSHYAATEQEITPGQYVLICVSDTGMGMDADTLSHAIEP
FFTTKDVGRGTGLGLSMVYGFVKQSGGHVRVYSEAGHGTTVKIYLPRYHGLLPVAEEIVQ
APPPPCPQAGREVILVCEDDENVRAYSVEVLRDLGYRVIEAGDGPTALAALDAAAEPIDL
LFTDVVLPGGMTGADIARAAKAKQPGLRVLFTTGYARNAIIHHGRLDPGVELLTKPFTYR
ALGEKIRDMLDRVESPVQ