Protein Info for GFF2583 in Sphingobium sp. HT1-2

Annotation: Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 166 to 191 (26 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details PF02628: COX15-CtaA" amino acids 19 to 334 (316 residues), 357.3 bits, see alignment E=3.5e-111

Best Hits

Swiss-Prot: 60% identical to CTAA_SPHAL: Heme A synthase (ctaA) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 83% identity to sch:Sphch_0080)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>GFF2583 Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA (Sphingobium sp. HT1-2)
MTRSSPTAFSAAPRPVAIARWLLIVAALVFCMVVVGGITRLTESGLSITQWKPITGAIPP
LTHDQWMEAFRDYQQIPEYKEINKGMSLAAFQFIFFWEWLHRLLGRLIGVAFALPLIWFA
ARRAIPAGYGWRLVALLALGGLQGAIGWWMVKSGLSVRTDVSHYRLAVHLLTALFIIGGL
IWTALDLLALARNPYARPAALQPFALATLLVLLVQLMFGAFTAGLDAGYVSSTWPLMNDH
LVPEGIQWLGSLWATVSSDPYLVHFIHRWWAWVAAAMLIILARKAKAAGHRGASIAINAA
VGTQVLLGIATVISGIALPLAVLHQAVGALVVASAAWGAHAVGSRRA