Protein Info for PS417_13155 in Pseudomonas simiae WCS417

Annotation: phosphatidylserine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF13091: PLDc_2" amino acids 36 to 148 (113 residues), 27.1 bits, see alignment E=3.4e-10 amino acids 252 to 390 (139 residues), 60.4 bits, see alignment E=1.7e-20 PF00614: PLDc" amino acids 129 to 154 (26 residues), 24.8 bits, see alignment (E = 1.7e-09) amino acids 349 to 375 (27 residues), 32 bits, see alignment (E = 8.5e-12)

Best Hits

Swiss-Prot: 54% identical to PSS_ECOLI: CDP-diacylglycerol--serine O-phosphatidyltransferase (pssA) from Escherichia coli (strain K12)

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 96% identity to pfs:PFLU2917)

MetaCyc: 54% identical to phosphatidylserine synthase (Escherichia coli K-12 substr. MG1655)
CDP-diacylglycerol--serine O-phosphatidyltransferase. [EC: 2.7.8.8]

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.8

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZA4 at UniProt or InterPro

Protein Sequence (447 amino acids)

>PS417_13155 phosphatidylserine synthase (Pseudomonas simiae WCS417)
MPSFFKRSLLPKLRGFSLSPDALEVLSSADAYRRCLLEKIAQATRRIYIVALYLQQDEAG
QEIYDALHAAKAARPELDIVVVVDWLRAQRGLIGAGKQPGNSAWYQAMTQRHSSEVPVYG
VPVQTRELFGVLHLKGFVIDDSVLYSGASLNNVYLHKFDKYRFDRYHLIHNKALADSMQH
LVEHGLVASKAVNRLDLPNPPTTRSLRNDIGDLRSRLKHATYDTTAGQLPNGQLSVSPLL
GVGKNNPLNRVILELIASAQHQLTICTPYFNLPLPVTREINRALARGVKIDIVVGDKTAN
DFYIPPSEPFKVIAALPYLYEISLRRFAKRHQPMIDSGQLNLHLWRDGDNTYHLKGMWID
QRYTLLTGNNLNPRAFRLDLENALLIDDPKHEWLVPRRTELAQIFQHTTRIERYQDLQTL
PDYPEAVGKFLRRVSRVRIERLLYRIL