Protein Info for GFF2580 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details PF08019: EptA_B_N" amino acids 46 to 194 (149 residues), 151 bits, see alignment E=2.4e-48 PF00884: Sulfatase" amino acids 222 to 522 (301 residues), 215.7 bits, see alignment E=9.7e-68

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 47% identity to pag:PLES_33511)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (557 amino acids)

>GFF2580 inner membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
LVAVWGLALWLASMGNLPLWQRIDGLGGSLGQRLALMLGLGLLLSGALAALLSLLAWPRV
FRPAASALLLIAAFNTHFMWQYGVVIDPTMLANVVHTDVREVRDLLSWALPGTVLLVAGW
PLWALWRRPLALRRAGPQAVRNLAGALAAIVLLVVAALLSYQGLASLMRNHKDLRYMANP
LNTVYAGARLAVDQFPRQVRPLQPVGEDAALGASYAHQPRPPLLVLVIGETARAQNFGLN
GYERNTTPALARWQSQGDLVNFGQVRSCGTNTLVSLPCIFSPLTRAQGGDKTPEHENLLD
VLQRAGLAVLWIDNQAGCKGVCDRVPNASAGDHAVPGLCEGSECYDTAMLDGLDQRIAAL
DPQRRARGVVLVMHQMGSHGPAYARRAPADRKPFQPECKSVTLSDCPHEQLVNAYDNSIA
YTDHFLDQTLRWLKARADQGSEDTGLLYVSDHGESLGENGLYLHGVPYALAPEQQTHVPM
VSWFSRGLQQRTGLSMNCLREHAAAPISHDHLFHSVLGLMDVQTRIYQPALDALAPCGAA
SQVKAPAGPTAPVAHTG