Protein Info for GFF2579 in Variovorax sp. SCN45

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF02548: Pantoate_transf" amino acids 31 to 291 (261 residues), 336.4 bits, see alignment E=6.1e-105 TIGR00222: 3-methyl-2-oxobutanoate hydroxymethyltransferase" amino acids 38 to 292 (255 residues), 293.4 bits, see alignment E=8.5e-92

Best Hits

Swiss-Prot: 79% identical to PANB_RHOFT: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 94% identity to vpe:Varpa_4760)

MetaCyc: 46% identical to 3-methyl-2-oxobutanoate hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>GFF2579 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Variovorax sp. SCN45)
MSNTTPPTETPPASPYGTLPPASPPASRKPVSLPRLADMHARGEKIAMLTAYDATFAAMA
DAAGIDCLLVGDSLGMVCQGLNSTVGVSLEAMRYHTDSVSRGLRRVQGTAWLIADLPFGS
YQESREQALRSATVLMQAGAHMVKLEGGGWTADTVRFLVERGIPVCAHLGLTPQTVHALG
GYRVQGKGDAAGALLKQQAHALQDAGAAMLVLEMVPAALAAELTAELTRCATIGIGAGRA
TAGQVLVLHDMLGINLGKMPRFVRNFMADAPGVLPALKAYVQAVKDGSFPDDRLHAW