Protein Info for GFF2576 in Xanthobacter sp. DMC5

Annotation: C4-dicarboxylate TRAP transporter large permease protein DctM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 136 to 163 (28 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 333 to 360 (28 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 414 to 438 (25 residues), see Phobius details PF06808: DctM" amino acids 16 to 437 (422 residues), 291.3 bits, see alignment E=6e-91 TIGR00786: TRAP transporter, DctM subunit" amino acids 21 to 442 (422 residues), 319.3 bits, see alignment E=1.6e-99

Best Hits

KEGG orthology group: None (inferred from 92% identity to azc:AZC_3301)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 4"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>GFF2576 C4-dicarboxylate TRAP transporter large permease protein DctM (Xanthobacter sp. DMC5)
MSTALVGLLYGGATLGTMFLGMPIAFALGAVAVLFMVGFMPAASLDTVTQNVYEEMASIT
LLSIPLFILKGAAIGKSRAGQDLYSALHAWMHKIPGGLGIANVFACALFAAMAGSSPATC
SAIGSAGIPEMRKRGYSGAFAAGLIAAGGTLGILLPPSITMILYAVAAEQSLGRLFLAGL
GPGLLLVMLFAGYAMVRFRQEYAAAKKAYAETGARSALLHEENLTLRDRFAALPRVLPFV
VLLTGVMVALYGGYATPSETAGLGGVLALALIALIYGVWTPKDLSPILTSTIRESTMLMM
IIGMSLLYSYVMSYLHISQAAAQAIVALNLSKWLLLATILVLVVVLGFFLPPVSIILMTA
PIILPPLKAAGFDLIWFGVVMTIVMEMGLIHPPVGLNIFVIKNIAPDIPLKDVIWGTVPF
VLLMLLAVILLCLFPQIATGFPDLVMGKGR