Protein Info for GFF2573 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Peptide deformylase (EC 3.5.1.88)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF01327: Pep_deformylase" amino acids 7 to 156 (150 residues), 178.3 bits, see alignment E=4e-57 TIGR00079: peptide deformylase" amino acids 8 to 163 (156 residues), 178.2 bits, see alignment E=4.4e-57

Best Hits

Swiss-Prot: 68% identical to DEF2_BORPE: Peptide deformylase 2 (def2) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 78% identity to adn:Alide_4270)

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.88

Use Curated BLAST to search for 3.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>GFF2573 Peptide deformylase (EC 3.5.1.88) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNSPSLLPILRYPDPRLHTVAKPVQAVDDRIRVLIERMFETMYDANGIGLAATQVDVHER
LIVIDVSEARDERLVLINPEIEWASPEKRKGEEGCLSVPGIYDGVERSIAVRVRALDADG
VERTIEAEGMLAVCIQHEMDHLLGKVFVEYLSPLKRDRIKSKLVKAQREAQRA