Protein Info for PS417_13110 in Pseudomonas simiae WCS417

Annotation: methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF08003: Methyltransf_9" amino acids 59 to 164 (106 residues), 26.8 bits, see alignment E=8.8e-10 PF01209: Ubie_methyltran" amino acids 60 to 165 (106 residues), 23.3 bits, see alignment E=1.3e-08 PF13489: Methyltransf_23" amino acids 60 to 162 (103 residues), 31.2 bits, see alignment E=6.1e-11 PF13847: Methyltransf_31" amino acids 61 to 164 (104 residues), 45.8 bits, see alignment E=1.8e-15 PF13649: Methyltransf_25" amino acids 63 to 158 (96 residues), 52.9 bits, see alignment E=1.8e-17 PF08241: Methyltransf_11" amino acids 66 to 162 (97 residues), 49.2 bits, see alignment E=2.4e-16 PF08242: Methyltransf_12" amino acids 68 to 160 (93 residues), 42.1 bits, see alignment E=4.1e-14

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfs:PFLU2907)

Predicted SEED Role

"FIG00955320: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6F4 at UniProt or InterPro

Protein Sequence (270 amino acids)

>PS417_13110 methylase (Pseudomonas simiae WCS417)
MDMPSAQQAIASNKDAWDQSASLHKTSDTWNVLLNSVGAADFSCLDPTLTGVLQDVGVVG
KDVVQLCCNNGRESLSLYGLGARSVVGVDQSQAFVQQARELAEVSPHNPEFIESDIHQLP
HSLQARFDIALVTIGVLGWMPDVKQFMRHVASTLKPGGTLVMYETHPFLEVFDPRAQNPF
LPASSYFQREPFVLQESIVYEGQGEVAGPTSYWYVHTLGDVVSAAIRADLQITNLQEYPH
SNREELYDQYEHQPAQLPMCFTLTATKRPG