Protein Info for GFF2570 in Sphingobium sp. HT1-2

Annotation: Uncharacterized amino acid permease, GabP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details amino acids 310 to 334 (25 residues), see Phobius details amino acids 366 to 382 (17 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details amino acids 445 to 463 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 37 to 439 (403 residues), 194.7 bits, see alignment E=4.2e-61 PF00324: AA_permease" amino acids 42 to 438 (397 residues), 128.2 bits, see alignment E=5.6e-41 PF13906: AA_permease_C" amino acids 418 to 468 (51 residues), 41.9 bits, see alignment 1.3e-14

Best Hits

Swiss-Prot: 44% identical to YHDG_BACSU: Uncharacterized amino acid permease YhdG (yhdG) from Bacillus subtilis (strain 168)

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 74% identity to cse:Cseg_0116)

Predicted SEED Role

"putative amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>GFF2570 Uncharacterized amino acid permease, GabP family (Sphingobium sp. HT1-2)
MTNRSPRHPLLIALLRCKPVLDFIGDDPDTKPLARNIGLFQLTMLGVGATIGTGIFVALT
TAVPEAGPAVTLSFVIAGITAALTALCYAEMASAVPASGSSYSYAYATMGELAAFLIGSC
LLLEYGVSASAIAVGWGQYLNELLSISTGWRLPDIIARPPGAGGIVNLPAVLLVGLCLIL
LLRGTRESTTANAILVIAKLAVLALFVAVALAHFQPANFHPFAPKGMVGIGAAASSIFFS
YIGIDAVSTAGEEVRNPRRDLPLAIILSLLIVTAAYILVAVAAIGAQPWTEFAGQEAGLA
VILHNLTSAGWPAVILSLGAIASIFSVTLVVIYGQTRILYAMGRDGLLPAFFCRVDPVRH
VPRQNTWIVAIGVALLAAFVPLDVLVNLTSMGTLIAFATVSIGVIILRRTRPDLPRGYKV
PFYPVLPIASTLFCAYLIFGLPADTYALFAVWVGAAALLYFGYSMRRSALAQR