Protein Info for GFF2567 in Variovorax sp. SCN45

Annotation: Molybdopterin-synthase adenylyltransferase (EC 2.7.7.80)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 33 to 50 (18 residues), see Phobius details PF00899: ThiF" amino acids 9 to 245 (237 residues), 258.8 bits, see alignment E=3.9e-81 PF03435: Sacchrp_dh_NADP" amino acids 31 to 148 (118 residues), 29.3 bits, see alignment E=9.5e-11

Best Hits

Swiss-Prot: 48% identical to THIF_ECOLI: Sulfur carrier protein ThiS adenylyltransferase (thiF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_4772)

MetaCyc: 48% identical to sulfur carrier protein ThiS adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-9789 [EC: 2.7.7.73]

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF2567 Molybdopterin-synthase adenylyltransferase (EC 2.7.7.80) (Variovorax sp. SCN45)
MEDSQLLRYSRHILLEEFGIDGQERVSAGRVLMIGAGGLGSPVALYLAAAGVGHIVLVDD
DEVDLTNLQRQVAHTHARVGLSKVESAAQAMRDINPDIYIETHAVRADDALLSRLVSQAD
VVIDCCDNFATRQAVNRACVAHAKPLVAGAAIRFDGQLSVYDTRDAASPCYACLFPPDAT
FEETRCAVLGVFGPVVGTIGTLQASEALKLLAGIGPSLAGKLLMFDGRSTSFDTLRVARD
PHCSVCGQRPHA