Protein Info for PS417_13055 in Pseudomonas simiae WCS417

Annotation: aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 139 to 173 (35 residues), see Phobius details PF04973: NMN_transporter" amino acids 3 to 180 (178 residues), 194.2 bits, see alignment E=9.2e-62 TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 4 to 181 (178 residues), 96.2 bits, see alignment E=1.1e-31

Best Hits

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 98% identity to pfs:PFLU2807)

Predicted SEED Role

"Ribosyl nicotinamide transporter, PnuC-like" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZ90 at UniProt or InterPro

Protein Sequence (187 amino acids)

>PS417_13055 aminotransferase (Pseudomonas simiae WCS417)
MSGLELFAAALGVIAVWLTVKQNPWCWPIGLVMVLLYTWVFFDVKLYSDMLLQVVYAALQ
VYGWWQWTRAGEVKQGRQVTSLGVPAIMASLAVGAVGSLLLGAAMAHWTDAAQPWLDAAL
TGFSLVAQMWMAQKRVQCWPLWIAVDVIFVGLFLYKGLYLTAALYALFTVIAVQGWREWR
ADPALHA