Protein Info for PS417_13050 in Pseudomonas simiae WCS417

Annotation: N-acetylglucosamine-6-sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13521: AAA_28
  • amino acids 4 to 160 (157 residues), 119.1 bits, E=1.2e-38

Best Hits

KEGG orthology group: None (inferred from 86% identity to pfs:PFLU2806)

Predicted SEED Role

"Ribosylnicotinamide kinase (EC 2.7.1.22)" in subsystem NAD and NADP cofactor biosynthesis global or PnuC-like transporters (EC 2.7.1.22)

MetaCyc Pathways

• NAD salvage pathway IV (from nicotinamide riboside) (1/2 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.22

Sequence Analysis Tools

See A0A1N7U9E6 at UniProt or InterPro

Protein Sequence (172 amino acids)

>PS417_13050 N-acetylglucosamine-6-sulfatase (Pseudomonas simiae WCS417)
MKVVVLAGPESSGKSWLAAELQAHFGGLMVGEYVRYFIDHHQRDTILADIPAIARGQMAW
EDDARAKQPELLILDTHLLTNKLWSQTLFGAYPAWLDSELLARHYDLHLLLSPEDVEWTA
DGQRCQPALADRQAFFQESLAWMQQHQETVVVIRGDWEARRKAAFAAVDKVL