Protein Info for PS417_01305 in Pseudomonas simiae WCS417

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF06490: FleQ" amino acids 8 to 121 (114 residues), 25.5 bits, see alignment E=5.5e-09 PF00072: Response_reg" amino acids 9 to 118 (110 residues), 99.5 bits, see alignment E=5.4e-32 PF00158: Sigma54_activat" amino acids 148 to 314 (167 residues), 228.7 bits, see alignment E=1.4e-71 PF14532: Sigma54_activ_2" amino acids 149 to 319 (171 residues), 66.1 bits, see alignment E=1.7e-21 PF07728: AAA_5" amino acids 171 to 290 (120 residues), 35.9 bits, see alignment E=3e-12 PF07724: AAA_2" amino acids 171 to 298 (128 residues), 31.4 bits, see alignment E=7.7e-11 PF25601: AAA_lid_14" amino acids 320 to 376 (57 residues), 54.1 bits, see alignment 4.5e-18 PF18024: HTH_50" amino acids 401 to 449 (49 residues), 32.1 bits, see alignment 3e-11

Best Hits

Swiss-Prot: 81% identical to DCTD_PSEAE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 98% identity to pfs:PFLU0286)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U5H5 at UniProt or InterPro

Protein Sequence (458 amino acids)

>PS417_01305 Fis family transcriptional regulator (Pseudomonas simiae WCS417)
MSIDNQIQVVLIDDDPHLRQALCQTLDLAGLNVLTLGEATGLTARLSRDWPGVVVSDIRM
PGMDGLELLAELHGQDPELPVLLITGHGDVPLAVQAMRAGAYDFLEKPFASDALLDSVRR
ALALRRLVLDNRSLRLALSDRQQLSTRLVGHSPQMLRLREQIGALAATRADVLILGETGA
GKEVVARALHDLSSRRSGPFVAINAGALAESVVESELFGHEPGAFTGAQKRRIGKFEFAN
GGTLFLDEIESMSLDVQVKLLRLLQERVVERLGGNQLIPLDIRIIAATKEDLRQSADQGR
FRADLYYRLNVAPLRIPPLRERGEDALMLFQHFADEASSRHGLPLHELQPGQRALLLRHS
WPGNVRELQNAAERFALGLELALDNTPDNPSAGTLTSTPGGLSEQVEQFEKSLIAAELTR
PHSSMRSLAEALGVPRKTLHDKLRKHGLNFANQSSDDE