Protein Info for GFF2557 in Sphingobium sp. HT1-2

Annotation: probable iron binding protein from the HesB_IscA_SufA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 4 to 108 (105 residues), 117.4 bits, see alignment E=1.6e-38 PF01521: Fe-S_biosyn" amino acids 4 to 103 (100 residues), 68.3 bits, see alignment E=3.1e-23

Best Hits

Swiss-Prot: 52% identical to ERPA2_BURVG: Putative iron-sulfur cluster insertion protein ErpA 2 (erpA2) from Burkholderia vietnamiensis (strain G4 / LMG 22486)

KEGG orthology group: None (inferred from 92% identity to sjp:SJA_C1-26690)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>GFF2557 probable iron binding protein from the HesB_IscA_SufA family (Sphingobium sp. HT1-2)
MADIDLTPSAAARVAAIAAKQGKPAILRLAVEGGGCSGFQYRFGLAEQVEAEDLAVERDG
VTLVVDDVSLDLVRGSAVDFVSDLGGAAFKVTNPNATAGCGCGTSFSV