Protein Info for GFF2556 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 55 to 76 (22 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details TIGR03022: undecaprenyl-phosphate galactose phosphotransferase WbaP" amino acids 57 to 528 (472 residues), 426.2 bits, see alignment E=2.1e-131 TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 60 to 528 (469 residues), 374.3 bits, see alignment E=1.1e-115 PF02397: Bac_transf" amino acids 331 to 523 (193 residues), 219.8 bits, see alignment E=1e-69

Best Hits

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>GFF2556 Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MARARIHSLKRPPLAKEQPGVEQPGVVVPLYNEHDLARNLAPWADLTQRQQKVKAWLVLT
DLSVLWLCFVAGRLPTWLRGDVTLGQAMNVWWAANGHLRLILFAAIALAMMTWMWTVQGH
YSAHRRKPWWDETRQLIQVIVLAALLDAMVIYLAKWPLSRLWTGATWGLVLICLPLARLV
VRTHLLRAGLLAQPYVLIGHPDDVEKAAAALASEPLLGYQPVAVVCPEPGARLVKLGGEQ
VAAPTALTPGVRQYLAQPSPYQLVGVLGIRDNAWLRELAQELMLTRDDLVMVPALGGLPI
YGMEVSHFFSHDVLLLRARNNLNRRGPQVLKRALDIVGSVTLLALLAPLFAWVAWRIKQD
DAGPVFFVQKRVGVDGQLFDFIKFRSMVMDADGALERWKTENEKLYVQYLASNFKLANDP
RITKIGRLIRRTSIDELPQLINVLRGEMSLVGPRPLLARELGDYGKSIAAYGKARPGITG
LWQISGRSTSTFQHRINMDLWYVRNWSLWYDLVIMLRTVRVVLRQEGAC