Protein Info for PS417_13015 in Pseudomonas simiae WCS417

Annotation: 6-hydroxynicotinate 3-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 6 to 342 (337 residues), 96.7 bits, E=4.4e-31
• PF13450: NAD_binding_8
  • amino acids 9 to 39 (31 residues), 31.9 bits, see alignment (E = 3.2e-11)

Best Hits

Swiss-Prot: 78% identical to 6HN3M_PSEPK: 6-hydroxynicotinate 3-monooxygenase (nicC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K14974, 6-hydroxynicotinate 3-monooxygenase [EC: 1.14.13.114] (inferred from 98% identity to pfs:PFLU2799)

MetaCyc: 78% identical to 6-hydroxynicotinate 3-monooxygenase (Pseudomonas putida KT2440)
RXN-7573 [EC: 1.14.13.114]

Predicted SEED Role

"Salicylate hydroxylase (EC 1.14.13.1)" in subsystem Salicylate and gentisate catabolism or Salicylate ester degradation (EC 1.14.13.1)

MetaCyc Pathways

• superpathway of salicylate degradation (7/7 steps found)
• nicotinate degradation I (6/6 steps found)
• methylsalicylate degradation (2/2 steps found)
• salicylate degradation I (1/1 steps found)
• chlorosalicylate degradation (2/7 steps found)
• naphthalene degradation to acetyl-CoA (2/12 steps found)
• superpathway of nicotinate degradation (6/18 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (15/42 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Bile acid biosynthesis
• Fluorene degradation
• Naphthalene and anthracene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.1 or 1.14.13.114

Sequence Analysis Tools

See A0A1N7U1H9 at UniProt or InterPro

Protein Sequence (377 amino acids)

>PS417_13015 6-hydroxynicotinate 3-monooxygenase (Pseudomonas simiae WCS417)
MGSTQKIAIVGAGLGGAAAATLLQQAGFDVDVYEQAPEFSRLGAGIHMGPNIMKIFRRMG
IEKQLDLMGSHPEHWFSRCGESGDYLSRIPLTGYGASYITVHRGDLHALQMSTLKPGTLH
FNKRLESLEETDTQVRLTFADGQVTYADIVIGADGINSKIREVLLGVEKPLYSGWVAHRA
LIRGDQLAKYDLKFEDCIKWWTEDRHMMVYYTTGKRDEYYYVTGVPHAEWDFQGAFVDSS
REEMFDAFQGYHPTVQALIESTESVTKWPLRNRNPLPLWSRGRLVLLGDACHPMKPHMAQ
GAGMAIEDAAMLTRCLQETGISDYRTAFELYEANRKERASRVQAVSNANTWLRTQEDPAW
VYGYDLYAQELKSGVAA