Protein Info for PS417_13005 in Pseudomonas simiae WCS417

Annotation: Asp/Glu racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 91% identical to MAIA_PSEPK: Maleate isomerase (maiA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01799, maleate isomerase [EC: 5.2.1.1] (inferred from 99% identity to pfs:PFLU2797)

MetaCyc: 99% identical to maleate isomerase monomer (Pseudomonas fluorescens ATCC 23728)
Maleate isomerase. [EC: 5.2.1.1]

Predicted SEED Role

"Maleate cis-trans isomerase (EC 5.2.1.1)" in subsystem Salicylate and gentisate catabolism (EC 5.2.1.1)

MetaCyc Pathways

nicotinate degradation I (6/6 steps found)
picolinate degradation (4/7 steps found)
nicotinate degradation II (2/5 steps found)
nicotine degradation III (VPP pathway) (5/10 steps found)
nicotine degradation II (pyrrolidine pathway) (5/11 steps found)
superpathway of nicotinate degradation (6/18 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZ84 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PS417_13005 Asp/Glu racemase (Pseudomonas simiae WCS417)
MQKPYRIGQIVPSSNTTMETEIPAMLTARQAIRPERFTFHSSRMRMKQVRKEELAAMDGE
SDRCAVELSDAKVDVLGYACLVAIMAMGLGYHRNSEQRLRKATADNDANAPVITSAGALI
EGLKVMGAKRIAIVAPYMKPLTELVVNYIREEGFEVVDWRALEIPDNLEVARHDPANLPA
IVAGMNLEGVDVIVLSACVQMQSLPVVAKVEAQTGKPVLTAAIATTYAMLKALDLEPIVP
GAGALLSGAY