Protein Info for GFF2546 in Sphingobium sp. HT1-2

Annotation: Fatty acid desaturase, type 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 52 to 82 (31 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 220 to 246 (27 residues), see Phobius details PF00487: FA_desaturase" amino acids 69 to 328 (260 residues), 93.8 bits, see alignment E=7.9e-31

Best Hits

KEGG orthology group: None (inferred from 83% identity to sch:Sphch_1516)

Predicted SEED Role

"Fatty acid desaturase, type 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>GFF2546 Fatty acid desaturase, type 2 (Sphingobium sp. HT1-2)
MTVHDPILAAASRTRSAIPDDTKMLRAAADLTRTLSTANPAIYWPDMLASALIGYGALAG
AILAQNVAIAIGCALLSMMALYRAASFIHELTHIRKGALPGFRFGWNLLVGIPLMIPSFL
YEGVHTQHHARTRYGTAEDPEYLPLALMKPWSLPLFIVVAALAPVGLILRFGVLTPLSLI
IPPLRRKVVAEFSALSINPAYRRRAPEGEFARMWHWQEAGACLFALALVGSVFAFGWKPL
LVYMAIHSAMTVINQLRTLVAHLWENEGEAMTVTAQYLDSVNVPPPGTLPELWAPVGLRY
HALHHLLPSVPYHNLAAAHRQLMATLDIDSPYRQGNYTGMFPLVAKIARSTMHAR