Protein Info for GFF2546 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG01045761: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 40 to 57 (18 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 140 to 166 (27 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 322 to 349 (28 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 445 to 467 (23 residues), see Phobius details TIGR00931: Na+/H+ antiporter NhaC" amino acids 13 to 469 (457 residues), 515.8 bits, see alignment E=4.8e-159 PF03553: Na_H_antiporter" amino acids 163 to 464 (302 residues), 195.7 bits, see alignment E=5.6e-62

Best Hits

Swiss-Prot: 55% identical to Y1107_HAEIN: Uncharacterized Na(+)/H(+) antiporter HI_1107 (HI_1107) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03315, Na+:H+ antiporter, NhaC family (inferred from 99% identity to ses:SARI_01415)

Predicted SEED Role

"FIG01045761: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>GFF2546 FIG01045761: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSASQNKKKTLSLGLALIPVISMLLLLIIGYGIMGLRIEPLLLCSAAVAAGIAWWQGYCW
EDIINSVVDKLAKAMPVIMILICVGGLIGSWMFSGTIPYMVYWGLKLISPEYILIAAFFL
TSVVSVCTGTSWGSAGTVGVALMGVAAGLDVSLAAAAGAVVSGAYFGDKISPLSDSTNFA
AIVADTTLFEHIQHLLWTTLPSFLLAAVVYLIAGHSNMLGEVATPQRVTDIIHSLESLYH
FNIVLILPPVIVLWGAIRKKPVIPLMLSACVLALFLGVIMQGLSIKQGLDAFIDGFDIAM
FPQGAEGVVADVPRLLNRGGMFSMMGTILLVFCAFSFAGALTLTGALTIIINRLLTIIHS
VGQLIAATIGTTILVTGATSDGKLALLVPAELFKDAYRRMGLDTKNLSRTIEDAGTVIEP
LLPWTSAGVYMATTLGVSTLDLLPWAIQCYAAIFFALIYGFSGIGIARTASASEKSPQSS
VTE